FOXO4-DRI Peptide: A Tool for Senescence Research
FOXO4-DRI peptide is a synthetic research compound designed to disrupt the interaction between FOXO4, a protein involved in cellular stress response, and p53, a regulator of cell cycle and apoptosis. This targeted disruption facilitates the selective removal of senescent cellsโnon-dividing cells that accumulate in tissues during agingโin laboratory test subjects.
Senescent cells are known for releasing inflammatory factors collectively called the senescence-associated secretory phenotype (SASP). These factors can contribute to cellular dysfunction and tissue degradation. FOXO4-DRI operates by binding to FOXO4 in these aging cells, preventing its interaction with p53. This action triggers apoptosis in senescent cells without affecting normal, dividing cells, making it an invaluable tool in studies focused on cellular aging and rejuvenation in laboratory test subjects.
Research using non-human models has highlighted FOXO4-DRI’s role in improving tissue health and cellular turnover. By clearing senescent cells, it reduces oxidative stress and enhances the overall cellular environment. These properties make it a focal point in laboratory studies exploring age-related tissue changes and cellular resilience.
Structurally, FOXO4-DRI is engineered for stability and bioavailability. It resists enzymatic degradation, ensuring consistent effects in controlled research environments.ย ย Known in scientific circles by other names such as FOXO4-D-Retro-Inverso Peptide, FOXO4-DRI continues to drive breakthroughs in the understanding of senescence, providing researchers with a robust tool for probing the molecular mechanisms of aging in non-human test subjects.
Summary of Characteristics
| Characteristic | Details |
|---|---|
| Chemical Sequence of Amino Acids | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP |
| CAS Number | 2460055-10-9 |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358.05 g/mol |
| Other Known Titles | FOXO4-D-Retro-Inverso Peptide, FOXO4-DRI |
