FOXO4-DRI peptide is a synthetic derivative designed to interact with the FOXO4 protein, a transcription factor involved in regulating cell survival, stress response, and DNA repair. This peptide is notable for its ability to disrupt interactions between FOXO4 and p53, a critical protein responsible for regulating the cell cycle and apoptosis in research models. By interfering with these interactions, FOXO4-DRI promotes the clearance of senescent cells—those that have stopped dividing but remain metabolically active—in laboratory test subjects.
In the lab, FOXO4-DRI has become a valuable tool for studying cellular aging, often referred to as senescence. These senescent cells are known to accumulate over time and release inflammatory factors, collectively termed the senescence-associated secretory phenotype (SASP). By targeting senescent cells, FOXO4-DRI has been observed to reduce SASP activity in research settings, leading to improved cellular environments and tissue function in test subjects.
The peptide’s mechanism involves selectively binding to FOXO4 in senescent cells, which disrupts its interaction with p53. This disruption triggers programmed cell death, or apoptosis, in these non-dividing cells, sparing healthy, dividing cells. This specificity makes FOXO4-DRI a promising molecule for research into anti-senescence strategies.
Research conducted in laboratory models demonstrates that FOXO4-DRI enhances tissue resilience, supports healthier cellular turnover, and mitigates the effects of oxidative stress and DNA damage in test subjects. Studies often focus on its potential to reverse or slow down age-related cellular changes in various tissues, providing insights into the molecular processes of aging.
Structurally, FOXO4-DRI is a modified peptide with enhanced stability and bioavailability for experimental use. It resists rapid degradation, making it highly effective in controlled research environments. Its safety profile in non-human test subjects is another area of active investigation, ensuring it functions predictably in diverse research scenarios.
In summary, FOXO4-DRI peptide serves as a cutting-edge research tool for studying cellular senescence and aging in test subjects. It offers a pathway for deeper understanding of age-related processes and supports exploration of novel strategies to modulate cellular health in laboratory settings.
Summary of Characteristics
| Characteristic | Details |
|---|---|
| Chemical Sequence of Amino Acids | LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP |
| CAS Number | 2460055-10-9 |
| Molecular Formula | C228H388N86O64 |
| Molecular Weight | 5358.05 g/mol |
| Other Known Titles | FOXO4-D-Retro-Inverso Peptide, FOXO4-DRI |